PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_63743.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 163aa    MW: 18248.9 Da    PI: 10.2942
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_63743.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.6e-51191431128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdeelv++yL+++++g ++++  +i+evd+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg dk+v s   
  MLOC_63743.3  19 LPPGFRFHPTDEELVMHYLCRRCAGLPISV-PIIAEVDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRSAGTGYWKATGADKPVGS--P 112
                   79****************************.88***************7666789*************************************99..7 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +   +kk Lvfy g+apkg kt+W+mheyrl
  MLOC_63743.3 113 KPLAIKKALVFYAGKAPKGDKTNWIMHEYRL 143
                   789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-5715146IPR003441NAC domain
PROSITE profilePS5100554.41719163IPR003441NAC domain
PfamPF023652.2E-2620143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MSGGGGGSAA TQGQQDLQLP PGFRFHPTDE ELVMHYLCRR CAGLPISVPI IAEVDLYKFD  60
PWQLPRMALY GEKEWYFFSP RDRKYPNGSR PNRSAGTGYW KATGADKPVG SPKPLAIKKA  120
LVFYAGKAPK GDKTNWIMHE YRLADVDRSA RKKNSLRAAF SRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-7061432140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3658120.0AK365812.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2037P06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970815.11e-100PREDICTED: NAC domain-containing protein 48
RefseqXP_015620920.11e-100PREDICTED: NAC domain-containing protein 48
RefseqXP_015698070.11e-100PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-102NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLM0XWR21e-119M0XWR2_HORVD; Uncharacterized protein
STRINGMLOC_63743.11e-113(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-92NAC family protein